Alpha This is a work in progress and may change. Your feedback is very welcome.
  


1T7Y

Non-classical MHC Class I molecule Zinc Alpha-2 Glycoprotein at 2.80Å resolution

Data provenance

Structure downloaded from PDB Europe using the Coordinate Server. Aligned to residues 1-180 of 1HHK2 using the CEALIGN3 function of PyMol4. Chain assigment using a Levenshtein distance5 method using data from the PDBe REST API6. Organism data from PDBe REST API. Data for both of these operations from the Molecules endpoint. Structure visualised with 3DMol7.

Information sections


Complex type

Zag

1. Zinc-Alpha-2-Glycoprotein
['A']

Species


Locus / Allele group

Non-classical MHC Class I molecule

Publication

Crystallographic studies of ligand binding by Zn-alpha2-glycoprotein.

Delker SL, West AP, McDermott L, Kennedy MW, Bjorkman PJ
J. Struct. Biol. (2004) 148, 205-13 [doi:10.1016/j.jsb.2004.04.009]  [pubmed:15477100

Zn-alpha2-glycoprotein (ZAG) is a 41 kDa soluble protein that is present in most bodily fluids. The previously reported 2.8 A crystal structure of ZAG isolated from human serum demonstrated the structural similarity between ZAG and class I major histocompatibility complex (MHC) molecules and revealed a non-peptidic ligand in the ZAG counterpart of the MHC peptide-binding groove. Here we present crystallographic studies to explore further the nature of the non-peptidic ligand in the ZAG groove. Comparison of the structures of several forms of recombinant ZAG, including a 1.95 A structure derived from ZAG expressed in insect cells, suggests that the non-peptidic ligand in the current structures and in the structure of serum ZAG is a polyethylene glycol (PEG), which is present in the crystallization conditions used. Further support for PEG binding in the ZAG groove is provided by the finding that PEG displaces a fluorophore-tagged fatty acid from the ZAG binding site. From these results we hypothesize that our purified forms of ZAG do not contain a bound endogenous ligand, but that the ZAG groove is capable of binding hydrophobic molecules, which may relate to its function.

Structure deposition and release

Deposited: 2004-05-11
Released: 2004-12-21
Revised: 2021-10-27

Data provenance

Publication data retrieved from PDBe REST API8 and PMCe REST API9

Other structures from this publication


Chain sequences

1. Zinc-Alpha-2-Glycoprotein
Zinc-Alpha-2-Glycoprotein
        10        20        30        40        50        60
QENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQVEGM
        70        80        90       100       110       120
EDWKQDSQLQKAREDIFMETLKDIVEYYKDSTGSHVLQGRFGCEIENNRSSGAFWKYYYD
       130       140       150       160       170       180
GKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNI
       190       200       210       220       230       240
LDRQDPPSVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNG
       250       260       270
TYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS


Data provenance

Sequences are retrieved via the Uniprot method of the RSCB REST API. Sequences are then compared to those derived from the PDB file and matched against sequences retrieved from the IPD-IMGT/HLA database for human sequences, or the IPD-MHC database for other species. Mouse sequences are matched against FASTA files from Uniprot. Sequences for the mature extracellular protein (signal petide and cytoplasmic tail removed) are compared to identical length sequences from the datasources mentioned before using either exact matching or Levenshtein distance based matching.


Downloadable data

Data can be downloaded to your local machine from the links below.
Clicking on the clipboard icon will copy the url for the data to your clipboard.
This can then be used to load the structure/data directly from the url into an application like PyMol (for 3D structures) using the load command:
   e.g. load http://www.histo.fyi/structures/downloads/1hhk_1_peptide.cif
or in the case of JSON formatted files to retrieve it and use it as part of notebooks such as Jupyter or GoogleColab.
Please take note of the data license. Using data from this site assumes that you have read and will comply with the license.

Complete structures

Aligned structures [cif]
  1. 1T7Y assembly 1  

Components

MHC Class I alpha chain [cif]
  1. 1T7Y assembly 1  
MHC Class I antigen binding domain (alpha1/alpha2) [cif]
  1. 1T7Y assembly 1  

Derived data

Data for this page [json]
https://api.histo.fyi/v1/structures/1t7y

Data license

The data above is made available under a Creative Commons CC-BY 4.0 license. This means you can copy, remix, transform, build upon and redistribute the material, but you must give appropriate credit, provide a link to the license, and indicate if changes were made.
If you use any data downloaded from this site in a publication, please cite 'https://www.histo.fyi/'. A preprint is in preparation.

Footnotes